PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1280s0040.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 713aa    MW: 78425.9 Da    PI: 9.3349
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1280s0040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.6e-094534901954
                             HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  SapurV1A.1280s0040.1.p 453 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 490
                             554459******************************88 PP

2BELL117.85.3e-38318388272
                    BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                             r+elq+k++kL+++l+eVd+rY+qy++q+q+v+ssFe++ag g+ak+Yt+lAl++iSr+Fr+Lkd i++qi
  SapurV1A.1280s0040.1.p 318 RHELQMKRTKLVNMLDEVDQRYRQYHHQMQVVVSSFEQAAGFGAAKSYTALALQTISRQFRSLKDTISSQI 388
                             89********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.9E-58241386IPR006563POX domain
PfamPF075263.1E-47246385IPR006563POX domain
PROSITE profilePS5007112.131431494IPR001356Homeobox domain
CDDcd000861.96E-12434495No hitNo description
SMARTSM003892.3E-9434498IPR001356Homeobox domain
SuperFamilySSF466897.7E-17435500IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.4E-29437500IPR009057Homeodomain-like
PfamPF059203.0E-18451490IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 713 aa     Download sequence    Send to blast
MFCFIIYLWR FRFIITLFGV LFFRSYLMAT YFHGSSDIQA AAAPSDGIQT LYLMNPNYLS  60
SYSDATPQQQ QSPNMIFFNH GSAAASNNSL SHGPPQNHHF VGIPLPVPSS NITSLSPDNH  120
SRPSSLHGVI PGAHYNIWGS IDQNSMASAA TAIESSGAHD FMSSQVGFRR PLVVSPGRQG  180
LSLSLSSQQA PAPPTSYSRA ISHEHEIQAL HPHVSVVSSG DEIRLSGTSP PSVSAVSNGF  240
SGMHNMILGS RYLRATQELL DEVANVGRDL IKSGFMGRTK EKMKMTKESV TGDGSDGSGE  300
AFGETSAKRG ADLTTAHRHE LQMKRTKLVN MLDEVDQRYR QYHHQMQVVV SSFEQAAGFG  360
AAKSYTALAL QTISRQFRSL KDTISSQIRA TSKSLGEEDC IGARAEGSRL RHVDHQLRQQ  420
RALQQLGMAQ HNAWRPQRGL PERAVSVLRA WLFEHFLHPY PKDSDKHMLA KQTGLTRSQV  480
SNWFINARVR LWKPMVEEMY LEETKEREKA GSEETGSKNE NKESGSQYSS APGETSTLHM  540
DQLKGAVLRS KQPEKTTNQN TNSPTKFSNP TISMSPMGAS FQQQSGFTLI GPAEMEEIAQ  600
RSSKKPRAGD MQNSPSSILS MDMDMKQGET SREIGVSFGG ERLSKDGYPL ITGSNGSFGA  660
YPMGDLGRFN IEQLTPRFSG NSVSLTLGLP HLFQERSKTS SPARTFSWAV ED*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A8e-17440498563Homeobox protein Meis2
3k2a_B8e-17440498563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299773.20.0hypothetical protein POPTR_0001s22430g
TrEMBLB9GHM60.0B9GHM6_POPTR; Uncharacterized protein
STRINGPOPTR_0001s22430.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16273492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-104BEL1-like homeodomain 1